ESMFold2 Guide and Browser Tools
Learn ESMFold2, generate starter code, prepare safe examples, and understand structure-confidence outputs without uploading private sequences or Biohub tokens.
ESMFold2 Quick Starter
Generate starter Python locally in your browser. Do not paste a private Biohub token here.
# !pip install <official Biohub ESMFold2 client package>
# Last verified: update against the current Biohub ESMFold2 docs before running.
# Official sources: https://biohub.ai/models/esmfold2 and https://github.com/Biohub/esm
import os
MODEL_ID = "esmfold2-fast-2026-05" # Verify model ID in official docs.
BIOHUB_TOKEN = os.environ["BIOHUB_TOKEN"]
# Replace these imports/client calls with the current official Biohub example.
from official_esmfold2_client import (
ESMFold2Client,
FoldingConfig,
StructurePredictionInput,
)
client = ESMFold2Client(
model=MODEL_ID,
token=BIOHUB_TOKEN,
)
prediction_input = StructurePredictionInput(
proteins=[{"id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVE"}],
)
result = client.fold_all_atom(
prediction_input,
config=FoldingConfig(
num_loops=1,
num_sampling_steps=8,
include_pae=True,
),
)
with open("esmfold2_result.cif", "w") as handle:
handle.write(result.mmcif)
Demo structure viewer
The viewer slot is ready, but it will only show a real mmCIF asset generated from the official ESMFold2 Colab workflow. No fabricated coordinates are used.
See how official examples are sourcedWhat is ESMFold2?
ESMFold2 is Biohub's ESMC-based structure prediction model for translating protein sequence representations into atom-level 3D structures and biomolecular complex examples. This site focuses on ESMFold2 guides, starter code, local input preparation, and confidence interpretation without running hosted predictions.
ESMFold2 in the Biohub world model
Keep the release components separate: ESMC is the model foundation, ESMFold2 is the structure prediction model, and ESM Atlas is the related browsing and discovery surface.
ESMC
Biohub's protein language model foundation in the protein biology world model release.
ESMFold2
The all-atom structure prediction model this site focuses on for guides and tools.
ESM Atlas
The large-scale predicted-structure atlas connected to the same model family.
Looking for ESMFold, ESMFold2, or ESM Atlas?
These related searches are useful, but they answer different questions. Use the focused guides below to separate official ESMFold2 sources from older ESMFold, ESM Atlas, and API workflows.
ESMFold2 Biohub
Use the Biohub page to verify the current model, API, GitHub, and source links.
Open guideSearch intentESMFold2 and ESM Atlas
See how ESMC, ESMFold2, and ESM Atlas fit into the same Biohub release.
Open guideSearch intentESMFold2 vs ESMFold
Separate the older ESMFold search intent from the newer ESMFold2 workflow.
Open guideSearch intentESMFold2 GitHub and API
Find the implementation source, Colab path, and safer starter-code workflow.
Open guideFree tools that stay local
The current MVP is Track A: content and browser-local tools. Hosted prediction, login, credits, queues, and result storage stay out of the first launch.
Code Generator
Generate Colab or local Python starter code with token placeholders and current-docs warnings.
Input Builder
Prepare single-chain and multi-chain ESMFold2 examples without uploading sequences.
mmCIF Viewer
Inspect ESMFold2 mmCIF/PDB outputs in the browser once the viewer is connected.
pLDDT / PAE Explainer
Turn confidence values and PAE JSON into careful report-ready wording.
What ESMFold2 can cover
Official sources position ESMFold2 for proteins and biomolecular complexes, including examples involving protein, DNA, RNA, and ligand-like components where official examples support them.
This MVP avoids overclaiming arbitrary ligand docking and avoids clinical, therapeutic, or wet-lab conclusions.
Explore ESMFold2 guides and tools
Safety boundary
Track B hosted prediction is intentionally delayed until acceptable-use, privacy, retention, payment, and biosafety review are ready.
Free tools do not collect sequences or tokens.
No proxying or reselling Biohub free platform APIs.
No LLM-generated fake structure coordinates.
No clinical, therapeutic, or drug-development conclusions.
Official ESMFold2 sources
These links are kept as citations for fact checking. Start with the on-site guides above, then use official sources when you need the current model page, notebook, repository, or release context.
Primary model page for current ESMFold2 details.
Biohub ESM GitHub repositoryOfficial code, cookbook examples, and license reference.
Official ESMFold2 ColabNotebook workflow for the official example path.
Biohub announcementRelease context for the protein biology world model.
Nature coverageThird-party reporting used only with attribution.
FAQ
Do the free tools call Biohub APIs?
No. The free tools run locally in the browser and only generate code, build examples, or prepare users to inspect files.
Can I run ESMFold2 predictions on this site?
Not in the Track A MVP. Hosted prediction is a later Phase 2 feature that requires sign-in, billing, and compliance review.
Should I paste a Biohub token into the tools?
No. Generated examples use placeholders and environment variables so private tokens stay in your own environment.
Is this an official Biohub website?
No. This is an independent guide and browser-local toolkit that links users to official Biohub sources.