ESMFold2 Tools logoESMFold2 Tools logoESMFold2 Tools
Home
  • What is ESMFold2

    Definition, release context, and model scope

  • GitHub guide

    Repository, examples, Colab, and license notes

  • Biohub

    Official model, API, GitHub, and Atlas sources

  • ESM Atlas

    How ESMFold2 relates to the Biohub atlas

  • API

    Generate and understand Biohub API code

  • Code Generator

    Create starter Python code for ESMFold2

  • ESMFold2 vs AlphaFold3

    Compare scope, claims, and practical workflow

  • ESMFold2 vs ESMFold

    Clarify old ESMFold and new ESMFold2 search intent

Phase 2
ESMFold2 released by Biohub on May 27, 2026

ESMFold2 Guide and Browser Tools

Learn ESMFold2, generate starter code, prepare safe examples, and understand structure-confidence outputs without uploading private sequences or Biohub tokens.

Open code generatorLearn ESMFold2
No hosted prediction in Track A
No private token collection
Not affiliated with Biohub

ESMFold2 Quick Starter

Generate starter Python locally in your browser. Do not paste a private Biohub token here.

# !pip install <official Biohub ESMFold2 client package>
# Last verified: update against the current Biohub ESMFold2 docs before running.
# Official sources: https://biohub.ai/models/esmfold2 and https://github.com/Biohub/esm

import os

MODEL_ID = "esmfold2-fast-2026-05"  # Verify model ID in official docs.
BIOHUB_TOKEN = os.environ["BIOHUB_TOKEN"]

# Replace these imports/client calls with the current official Biohub example.
from official_esmfold2_client import (
    ESMFold2Client,
    FoldingConfig,
    StructurePredictionInput,
)

client = ESMFold2Client(
    model=MODEL_ID,
    token=BIOHUB_TOKEN,
)

prediction_input = StructurePredictionInput(
    proteins=[{"id": "A", "sequence": "MKTAYIAKQRQISFVKSHFSRQDILDLWIYHTQGYFPDWQNYTPGPGIRYPLTFGWCFKLVPVE"}],
)

result = client.fold_all_atom(
    prediction_input,
    config=FoldingConfig(
        num_loops=1,
        num_sampling_steps=8,
        include_pae=True,
    ),
)

with open("esmfold2_result.cif", "w") as handle:
    handle.write(result.mmcif)
Open full code generator

Demo structure viewer

The viewer slot is ready, but it will only show a real mmCIF asset generated from the official ESMFold2 Colab workflow. No fabricated coordinates are used.

See how official examples are sourced

What is ESMFold2?

ESMFold2 is Biohub's ESMC-based structure prediction model for translating protein sequence representations into atom-level 3D structures and biomolecular complex examples. This site focuses on ESMFold2 guides, starter code, local input preparation, and confidence interpretation without running hosted predictions.

ESMFold2 in the Biohub world model

Keep the release components separate: ESMC is the model foundation, ESMFold2 is the structure prediction model, and ESM Atlas is the related browsing and discovery surface.

ESMC

Biohub's protein language model foundation in the protein biology world model release.

ESMFold2

The all-atom structure prediction model this site focuses on for guides and tools.

ESM Atlas

The large-scale predicted-structure atlas connected to the same model family.

Looking for ESMFold, ESMFold2, or ESM Atlas?

These related searches are useful, but they answer different questions. Use the focused guides below to separate official ESMFold2 sources from older ESMFold, ESM Atlas, and API workflows.

Search intent

ESMFold2 Biohub

Use the Biohub page to verify the current model, API, GitHub, and source links.

Open guide
Search intent

ESMFold2 and ESM Atlas

See how ESMC, ESMFold2, and ESM Atlas fit into the same Biohub release.

Open guide
Search intent

ESMFold2 vs ESMFold

Separate the older ESMFold search intent from the newer ESMFold2 workflow.

Open guide
Search intent

ESMFold2 GitHub and API

Find the implementation source, Colab path, and safer starter-code workflow.

Open guide

Free tools that stay local

The current MVP is Track A: content and browser-local tools. Hosted prediction, login, credits, queues, and result storage stay out of the first launch.

Live

Code Generator

Generate Colab or local Python starter code with token placeholders and current-docs warnings.

Next

Input Builder

Prepare single-chain and multi-chain ESMFold2 examples without uploading sequences.

Next

mmCIF Viewer

Inspect ESMFold2 mmCIF/PDB outputs in the browser once the viewer is connected.

Next

pLDDT / PAE Explainer

Turn confidence values and PAE JSON into careful report-ready wording.

What ESMFold2 can cover

Official sources position ESMFold2 for proteins and biomolecular complexes, including examples involving protein, DNA, RNA, and ligand-like components where official examples support them.

This MVP avoids overclaiming arbitrary ligand docking and avoids clinical, therapeutic, or wet-lab conclusions.

Explore ESMFold2 guides and tools

What is ESMFold2GitHub guideAPI guideESMFold2 vs ESMFoldCode generator

Safety boundary

Track B hosted prediction is intentionally delayed until acceptable-use, privacy, retention, payment, and biosafety review are ready.

Free tools do not collect sequences or tokens.

No proxying or reselling Biohub free platform APIs.

No LLM-generated fake structure coordinates.

No clinical, therapeutic, or drug-development conclusions.

Official ESMFold2 sources

These links are kept as citations for fact checking. Start with the on-site guides above, then use official sources when you need the current model page, notebook, repository, or release context.

Biohub ESMFold2 model page

Primary model page for current ESMFold2 details.

Biohub ESM GitHub repository

Official code, cookbook examples, and license reference.

Official ESMFold2 Colab

Notebook workflow for the official example path.

Biohub announcement

Release context for the protein biology world model.

Nature coverage

Third-party reporting used only with attribution.

FAQ

Do the free tools call Biohub APIs?

No. The free tools run locally in the browser and only generate code, build examples, or prepare users to inspect files.

Can I run ESMFold2 predictions on this site?

Not in the Track A MVP. Hosted prediction is a later Phase 2 feature that requires sign-in, billing, and compliance review.

Should I paste a Biohub token into the tools?

No. Generated examples use placeholders and environment variables so private tokens stay in your own environment.

Is this an official Biohub website?

No. This is an independent guide and browser-local toolkit that links users to official Biohub sources.

ESMFold2 Tools logoESMFold2 Tools logoESMFold2 Tools

A third-party ESMFold2 guide, code generator, input builder, and structure inspection toolkit.

Learn
  • What is ESMFold2
  • GitHub
  • Biohub
  • ESM Atlas
  • API
Tools
  • Code Generator
  • Phase 2 waitlist
Compare
  • vs AlphaFold3
  • vs ESMFold
About
  • About
  • Contact
  • Privacy
  • Terms
© 2026 ESMFold2 Tools. All Rights Reserved.